Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PLAU/uPA Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04185

PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749.

PLAU/uPA Protein, Human, Recombinant (His)

PLAU/uPA Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04185
PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$5620 days20 days
10 μg$8820 days20 days
20 μg$143-In Stock
50 μg$23920 days20 days
100 μg$36220 days20 days
200 μg$58320 days20 days
500 μg$1,08020 days20 days
1 mg$1,80020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug.
Description
PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberP00749
Synonyms
Urokinase-type plasminogen activator,U-plasminogen activator,uPA,PLAU
Amino Acid
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Construction
21-431 aa
Protein Purity
>95% as determined by SDS-PAGE.
PLAU/uPA Protein, Human, Recombinant (His)
Molecular Weight47.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.