Shopping Cart
- Remove All
- Your shopping cart is currently empty
PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $56 | 20 days | |
10 μg | $88 | 20 days | |
20 μg | $143 | In Stock | |
50 μg | $239 | 20 days | |
100 μg | $362 | 20 days | |
200 μg | $583 | 20 days | |
500 μg | $1,080 | 20 days | |
1 mg | $1,800 | 20 days |
Biological Activity | Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug. |
Description | PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-10xHis |
Accession Number | P00749 |
Synonyms | Urokinase-type plasminogen activator,U-plasminogen activator,uPA,PLAU |
Amino Acid | SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
Construction | 21-431 aa |
Protein Purity | >95% as determined by SDS-PAGE. ![]() |
Molecular Weight | 47.9 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.