Shopping Cart

Your shopping cart is currently empty

PLAU/uPA Protein, Human, Recombinant (His)

Name: PLAU/uPA Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04185
Rating: 4.5 (1 reviews)

(Synonyms: Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU) Copy Product Info

Synonyms: Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU

Catalog No. TMPH-04185 Copy Product Info

Purity: 97%

PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$56	20 days	20 days
10 μg	$88	20 days	20 days
20 μg	$143	-	In Stock
50 μg	$239	20 days	20 days
100 μg	$362	20 days	20 days
200 μg	$583	20 days	20 days
500 μg	$1,080	20 days	20 days
1 mg	$1,800	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:97%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug.
Description	PLAU/uPA Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P00749.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P00749
Amino Acid	SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Construction	21-431 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU

Chemical Properties

Molecular Weight

47.9 kDa (Predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: PLAU/uPA Protein, Human, Recombinant (His) chemical structure | PLAU/uPA Protein, Human, Recombinant (His) molecular weight