Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Plasminogen Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04060 Copy Product Info
Plasminogen Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P00747.

Plasminogen Protein, Human, Recombinant

Catalog No. TMPH-04060
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Plasminogen Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P00747.

Plasminogen Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$8120 days20 days
10 μg$13020 days20 days
20 μg$19620 days20 days
50 μg$35920 days20 days
100 μg$56320 days20 days
200 μg$79820 days20 days
500 μg$1,27020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The specific activity determined by an assay on anti-proliferation and anti-migration using endothelial cells in vitro and anti-angiogenesis in vivo is 5.5 × 105 IU/mg.
Description
Plasminogen Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P00747.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP00747
Synonyms
PLG,Plasminogen
Amino Acid
VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP
Construction
98-356 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight29.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM NaAc, pH 5.5, 4 % mannitol
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.