Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: PLG, Plasminogen


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $81 | 20 days | 20 days | |
| 10 µg | $130 | 20 days | 20 days | |
| 20 µg | $196 | 20 days | 20 days | |
| 50 µg | $359 | 20 days | 20 days | |
| 100 µg | $563 | 20 days | 20 days | |
| 200 µg | $798 | 20 days | 20 days | |
| 500 µg | $1,270 | 20 days | 20 days |
| Bioactivity | Fully biologically active when compared to standard. The specific activity determined by an assay on anti-proliferation and anti-migration using endothelial cells in vitro and anti-angiogenesis in vivo is 5.5 × 105 IU/mg. |
| Description | Plasminogen Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P00747. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P00747 |
| Amino Acid | VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP |
| Construction | 98-356 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM NaAc, pH 5.5, 4 % mannitol |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | PLG, Plasminogen |
| Molecular Weight | 29.7 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.