Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Phl p 1 Protein, Phleum pratense, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04451 Copy Product Info
Phl p 1 Protein, Phleum pratense, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P43213.

Phl p 1 Protein, Phleum pratense, Recombinant (hFc)

Catalog No. TMPH-04451
Copy Product Info
TargetMol | SPR

Phl p 1 Protein, Phleum pratense, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P43213.

Phl p 1 Protein, Phleum pratense, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$8120 days20 days
10 μg$12920 days20 days
20 μg$21620 days20 days
50 μg$31620 days20 days
100 μg$42320 days20 days
200 μg$78720 days20 days
500 μg$1,89020 days20 days
1 mg$3,63020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Phl p 1 Protein, Phleum pratense, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P43213.
Species
Phleum pratense
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP43213
Synonyms
Pollen allergen Phl p 1,PHLPI,Allergen Phl p I
Amino Acid
IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK
Construction
24-263 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight55.1 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 88 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.