Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03230 Copy Product Info
This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 50.9 kDa and the accession number is P12625.

PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His)

Catalog No. TMPH-03230
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 50.9 kDa and the accession number is P12625.

PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 50.9 kDa and the accession number is P12625.
Species
Ralstonia pickettii
Expression System
E. coli
TagN-6xHis
Accession NumberP12625
Synonyms
Poly(3-hydroxybutyrate) depolymerase,PHB depolymerase
Amino Acid
ATAGPGAWSSQQTWAADSVNGGNLTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSVADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQIGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGPMDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAHAWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAGSGTGQAGSAPTGLAVTATTSTSVSLSWNAVANASSYGVYRNGSKVGSATATAYTDSGLIAGTTYSYTVTAVDPTAGESQPSAAVSATTKSAFTCTATTASNYAHVQAGRAHDSGGIAYANGSNQSMGLDNLFYTSTLAQTAAGYYIVGNCP
Construction
28-488 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight50.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.