Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His)

Catalog No. TMPH-03230

This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 50.9 kDa and the accession number is P12625.

PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His)

PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His)

Catalog No. TMPH-03230
This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 50.9 kDa and the accession number is P12625.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. PHB depolymerase Protein, Ralstonia pickettii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 50.9 kDa and the accession number is P12625.
Species
Ralstonia pickettii
Expression System
E. coli
TagN-6xHis
Accession NumberP12625
Synonyms
Poly(3-hydroxybutyrate) depolymerase,PHB depolymerase
Amino Acid
ATAGPGAWSSQQTWAADSVNGGNLTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSVADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQIGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGPMDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAHAWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAGSGTGQAGSAPTGLAVTATTSTSVSLSWNAVANASSYGVYRNGSKVGSATATAYTDSGLIAGTTYSYTVTAVDPTAGESQPSAAVSATTKSAFTCTATTASNYAHVQAGRAHDSGGIAYANGSNQSMGLDNLFYTSTLAQTAAGYYIVGNCP
Construction
28-488 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight50.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.