Phax Protein, Mouse, Recombinant (His)

Name: Phax Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04475
Rating: 4.5 (1 reviews)

(Synonyms: Rnuxa, RNA U small nuclear RNA export adapter protein, Phosphorylated adapter RNA export protein, Phax) Copy Product Info

Synonyms: Rnuxa, RNA U small nuclear RNA export adapter protein, Phosphorylated adapter RNA export protein, Phax

Catalog No. TMPH-04475 Copy Product Info

Phax Protein, Mouse, Recombinant (His) is expressed in E. coli. The accession number is Q9JJT9.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$98	20 days	20 days
10 µg	$159	20 days	20 days
20 µg	$266	20 days	20 days
50 µg	$378	20 days	20 days
100 µg	$498	20 days	20 days
200 µg	$769	20 days	20 days
500 µg	$1,370	20 days	20 days
1 mg	$2,130	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Phax Protein, Mouse, Recombinant (His) is expressed in E. coli. The accession number is Q9JJT9.
Species	Mouse
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q9JJT9
Amino Acid	ALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF
Construction	2-385 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Rnuxa, RNA U small nuclear RNA export adapter protein, Phosphorylated adapter RNA export protein, Phax

Chemical Properties

Molecular Weight

46.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 112 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.