Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Phax Protein, Mouse, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04475

Phax Protein, Mouse, Recombinant (His) is expressed in E. coli. The accession number is Q9JJT9.

Phax Protein, Mouse, Recombinant (His)

Phax Protein, Mouse, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04475
Phax Protein, Mouse, Recombinant (His) is expressed in E. coli. The accession number is Q9JJT9.
Pack SizePriceAvailabilityQuantity
5 μg$9820 days
10 μg$15920 days
20 μg$26620 days
50 μg$37820 days
100 μg$49820 days
200 μg$76920 days
500 μg$1,37020 days
1 mg$2,13020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Phax Protein, Mouse, Recombinant (His) is expressed in E. coli. The accession number is Q9JJT9.
Species
Mouse
Expression System
E. coli
TagN-10xHis
Accession NumberQ9JJT9
Synonyms
Rnuxa,RNA U small nuclear RNA export adapter protein,Phosphorylated adapter RNA export protein,Phax
Amino Acid
ALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF
Construction
2-385 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight46.7 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 112 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.