Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PCSK6 Protein, Human, Recombinant (hFc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04076 Copy Product Info
PCSK6 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is P29122.

PCSK6 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04076
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

PCSK6 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is P29122.

PCSK6 Protein, Human, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$16720 days20 days
10 μg$27820 days20 days
20 μg$46520 days20 days
50 μg$83320 days20 days
100 μg$1,30020 days20 days
200 μg$1,96020 days20 days
500 μg$3,55020 days20 days
1 mg$5,48020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
PCSK6 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is P29122.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP29122
Synonyms
Subtilisin-like proprotein convertase 4 (SPC4),Subtilisin/kexin-like protease PACE4,Proprotein convertase subtilisin/kexin type 6,PCSK6,Paired basic amino acid cleaving enzyme 4,PACE4
Amino Acid
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Construction
860-969 aa
Protein Purity
>90% as determined by SDS-PAGE.
Molecular Weight43.6 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords