Shopping Cart
- Remove All
Your shopping cart is currently empty
NT-4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P34130.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $223 | 7-10 days | |
| 10 μg | $368 | 7-10 days | |
| 20 μg | $623 | 7-10 days | |
| 50 μg | $1,220 | 7-10 days | |
| 100 μg | $2,120 | 7-10 days | |
| 200 μg | $2,930 | 7-10 days | |
| 500 μg | $4,780 | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg |
| Description | NT-4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P34130. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P34130 |
| Synonyms | NTF5,NTF4,NT-4,Neutrophic factor 4,Neurotrophin-5 (NT-5),Neurotrophin-4 |
| Amino Acid | M+GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
| Construction | 81-210 aa |
| Protein Purity | >97% as determined by SDS-PAGE. |
| Molecular Weight | 14.1 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 5.5 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.