NPY Protein, Mouse, Recombinant (hFc)

Name: NPY Protein, Mouse, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-02843
Rating: 4.5 (1 reviews)

(Synonyms: Pro-neuropeptide Y, Npy) Copy Product Info

Synonyms: Pro-neuropeptide Y, Npy

Catalog No. TMPH-02843 Copy Product Info

NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$238	20 days	20 days
20 µg	$397	20 days	20 days
50 µg	$597	20 days	20 days
100 µg	$845	20 days	20 days
200 µg	$1,230	20 days	20 days
500 µg	$1,980	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-hFc
Accession Number	P57774
Amino Acid	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Construction	29-64 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Pro-neuropeptide Y, Npy
Research Background	NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Chemical Properties

Molecular Weight

30.9 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.