Shopping Cart
- Remove All
Your shopping cart is currently empty
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $143 | 20 days | |
| 10 μg | $238 | 20 days | |
| 20 μg | $397 | 20 days | |
| 50 μg | $597 | 20 days | |
| 100 μg | $845 | 20 days | |
| 200 μg | $1,230 | 20 days | |
| 500 μg | $1,980 | 20 days | |
| 1 mg | $2,970 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
| Species | Mouse |
| Expression System | P. pastoris (Yeast) |
| Tag | N-hFc |
| Accession Number | P57774 |
| Synonyms | Pro-neuropeptide Y,Npy |
| Amino Acid | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Construction | 29-64 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 30.9 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.