MYL12B Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04601

MYL12B Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is O14950.

MYL12B Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04601

MYL12B Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is O14950.

Pack Size	Price	Availability
5 μg	$139	20 days
10 μg	$229	20 days
20 μg	$382	20 days
50 μg	$547	20 days
100 μg	$720	20 days
200 μg	$1,080	20 days
500 μg	$1,930	20 days
1 mg	$2,970	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	MYL12B Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is O14950.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	C-10xHis
Accession Number	O14950
Synonyms	SHUJUN-1,Myosin regulatory light chain MRLC2,Myosin regulatory light chain 2-B, smooth muscle isoform,Myosin regulatory light chain 20 kDa (MLC20),Myosin regulatory light chain 12B,MYLC2B,MYL12B,MRLC2,MLC-2A (MLC-2)
Amino Acid	MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Construction	1-172 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	21.8 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 238 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.