Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Mucin-16/MUC16 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01706 Copy Product Info
Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.

Mucin-16/MUC16 Protein, Human, Recombinant (His)

Catalog No. TMPH-01706
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.

Mucin-16/MUC16 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$5020 days20 days
10 μg$7920 days20 days
20 μg$12720 days20 days
50 μg$22520 days20 days
100 μg$35020 days20 days
200 μg$63320 days20 days
500 μg$1,39020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/mL can bind MSLN, the EC 50 is 460.7-662.2 ng/mL.
Description
Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.
Species
Human
Expression System
HEK293 Cells
TagC-6xHis
Accession NumberQ8WXI7
Synonyms
Ovarian carcinoma antigen CA125,Ovarian cancer-related tumor marker CA125 (CA-125),Mucin-16,MUC-16,MUC16,CA125
Amino Acid
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Construction
12660-12923 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight30.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords