Mucin-16/MUC16 Protein, Human, Recombinant (His)

Catalog No. TMPH-01706 Copy Product Info

Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.

Mucin-16/MUC16 Protein, Human, Recombinant (His)

Catalog No. TMPH-01706

Copy Product Info

Mucin-16/MUC16 Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$50	20 days	20 days
10 μg	$79	20 days	20 days
20 μg	$127	20 days	20 days
50 μg	$225	20 days	20 days
100 μg	$350	20 days	20 days
200 μg	$633	20 days	20 days
500 μg	$1,390	20 days	20 days
1 mg	$2,550	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/mL can bind MSLN, the EC 50 is 460.7-662.2 ng/mL.
Description	Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.
Species	Human
Expression System	HEK293 Cells
Tag	C-6xHis
Accession Number	Q8WXI7
Synonyms	Ovarian carcinoma antigen CA125,Ovarian cancer-related tumor marker CA125 (CA-125),Mucin-16,MUC-16,MUC16,CA125
Amino Acid	GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Construction	12660-12923 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	30.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Mucin16 MUC 16 CA-125 CA 125