Mucin-16/MUC16 Protein, Human, Recombinant (His)

Catalog No. TMPH-01706

Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.

Mucin-16/MUC16 Protein, Human, Recombinant (His)

Catalog No. TMPH-01706

Pack Size	Price	Availability
5 μg	$50	20 days
10 μg	$79	20 days
20 μg	$127	20 days
50 μg	$225	20 days
100 μg	$350	20 days
200 μg	$633	20 days
500 μg	$1,390	20 days
1 mg	$2,550	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/mL can bind MSLN, the EC 50 is 460.7-662.2 ng/mL.
Description	Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.
Species	Human
Expression System	HEK293 Cells
Tag	C-6xHis
Accession Number	Q8WXI7
Synonyms	Ovarian carcinoma antigen CA125,Ovarian cancer-related tumor marker CA125 (CA-125),Mucin-16,MUC-16,MUC16,CA125
Amino Acid	GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Construction	12660-12923 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	30.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.