Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 154.00 | |
100 μg | 20 days | $ 371.00 |
Description | Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. |
Species | Human |
Expression System | HEK293 |
Tag | C-terminal 6xHis-tagged |
Accession Number | Q8WXI7 |
Amino Acid | GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM |
Construction | 12660-12923 aa |
Protein Purity | > 95% as determined by SDS-PAGE. |
Molecular Weight | 30.5 kDa (predicted) |
Endotoxin | < 1.0 EU per μg protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein