Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

GDF-8 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01415 Copy Product Info
Acts specifically as a negative regulator of skeletal muscle growth. MSTN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.4 kDa and the accession number is O14793.

GDF-8 Protein, Human, Recombinant (His)

Catalog No. TMPH-01415
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Acts specifically as a negative regulator of skeletal muscle growth. MSTN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.4 kDa and the accession number is O14793.

GDF-8 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$7520 days20 days
10 μg$11920 days20 days
20 μg$19820 days20 days
50 μg$29720 days20 days
100 μg$42720 days20 days
200 μg$65820 days20 days
500 μg$1,17020 days20 days
1 mg$1,83020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Acts specifically as a negative regulator of skeletal muscle growth. MSTN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.4 kDa and the accession number is O14793.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberO14793
Synonyms
Myostatin,MSTN,Growth/differentiation factor 8,GDF-8,GDF8
Amino Acid
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Construction
267-375 aa
Protein Purity
> 90% as determined by SDS-PAGE.
GDF-8 Protein, Human, Recombinant (His)
Molecular Weight16.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Acts specifically as a negative regulator of skeletal muscle growth.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords