Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

MMP-1 Protein, Human, Recombinant (E. coli, His)

TargetMol | SPR
Catalog No. TMPH-04623 Copy Product Info
MMP-1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P03956.

MMP-1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-04623
Copy Product Info
TargetMol | SPR

MMP-1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P03956.

MMP-1 Protein, Human, Recombinant (E. coli, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$8720 days20 days
10 μg$13920 days20 days
20 μg$232-In Stock
50 μg$32920 days20 days
100 μg$43520 days20 days
200 μg$67320 days20 days
500 μg$1,18020 days20 days
1 mg$1,87020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
MMP-1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P03956.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberP03956
Synonyms
MMP1,Matrix metalloproteinase-1 (MMP-1),Interstitial collagenase,Fibroblast collagenase,CLG
Amino Acid
IGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Construction
270-469 aa
Protein Purity
> 85% as determined by SDS-PAGE.
MMP-1 Protein, Human, Recombinant (E. coli, His)
Molecular Weight24.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 260 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords