Mcpt4 Protein, Mouse, Recombinant (His)

Name: Mcpt4 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02779
Rating: 4.5 (1 reviews)

(Synonyms: Serosal mast cell protease, Myonase, MSMCP, mMCP-4, Mcpt4, Mast cell protease 4) Copy Product Info

Synonyms: Serosal mast cell protease, Myonase, MSMCP, mMCP-4, Mcpt4, Mast cell protease 4

Catalog No. TMPH-02779 Copy Product Info

Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast.

Pack Size	Price	USA Stock	Global Stock
5 µg	$193	20 days	20 days
10 µg	$322	20 days	20 days
20 µg	$540	20 days	20 days
50 µg	$783	20 days	20 days
100 µg	$1,080	20 days	20 days
200 µg	$1,660	20 days	20 days
500 µg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P21812
Amino Acid	IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Construction	21-246 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Serosal mast cell protease, Myonase, MSMCP, mMCP-4, Mcpt4, Mast cell protease 4
Research Background	Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-\|-Ile-5' bond of angiotensin I and the 'Phe-20-\|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-\|-His-9' bond of angiotensin I and the 'Phe-4-\|-Ala-5' and 'Tyr-10-\|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.

Chemical Properties

Molecular Weight

27.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.