Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Mcpt4 Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02779 Copy Product Info
Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast.

Mcpt4 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02779
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast.

Mcpt4 Protein, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$19320 days20 days
10 μg$32220 days20 days
20 μg$54020 days20 days
50 μg$78320 days20 days
100 μg$1,08020 days20 days
200 μg$1,66020 days20 days
500 μg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP21812
Synonyms
Serosal mast cell protease,Myonase,MSMCP,mMCP-4,Mcpt4,Mast cell protease 4
Amino Acid
IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Construction
21-246 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Mcpt4 Protein, Mouse, Recombinant (His)
Molecular Weight27.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords