Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6D Protein, Mouse, Recombinant (mFc)

TargetMol | SPR
Catalog No. TMPH-04484 Copy Product Info
LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.

LY6D Protein, Mouse, Recombinant (mFc)

Catalog No. TMPH-04484
Copy Product Info
TargetMol | SPR

LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.

LY6D Protein, Mouse, Recombinant (mFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13920 days20 days
10 μg$22920 days20 days
20 μg$38220 days20 days
50 μg$54720 days20 days
100 μg$72020 days20 days
200 μg$1,08020 days20 days
500 μg$1,93020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagC-mFc
Accession NumberP35459
Synonyms
Thymocyte B-cell antigen (ThB),Thb,Lymphocyte antigen 6D,Ly-6D,Ly6d,Ly61
Amino Acid
LRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVS
Construction
21-98 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight35.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 121 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords