Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6D Protein, Mouse, Recombinant (mFc)

TargetMol | SPR
Catalog No. TMPH-04484

LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.

LY6D Protein, Mouse, Recombinant (mFc)

LY6D Protein, Mouse, Recombinant (mFc)

TargetMol | SPR
Catalog No. TMPH-04484
LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.
Pack SizePriceAvailabilityQuantity
5 μg$13920 days
10 μg$22920 days
20 μg$38220 days
50 μg$54720 days
100 μg$72020 days
200 μg$1,08020 days
500 μg$1,93020 days
1 mg$2,97020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagC-mFc
Accession NumberP35459
Synonyms
Thymocyte B-cell antigen (ThB),Thb,Lymphocyte antigen 6D,Ly-6D,Ly6d,Ly61
Amino Acid
LRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVS
Construction
21-98 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight35.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 121 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords