LY6D Protein, Mouse, Recombinant (mFc)

Name: LY6D Protein, Mouse, Recombinant (mFc)
Brand: TargetMol
SKU: TMPH-04484
Rating: 4.5 (1 reviews)

(Synonyms: Thymocyte B-cell antigen (ThB), Thb, Lymphocyte antigen 6D, Ly-6D, Ly6d, Ly61) Copy Product Info

Synonyms: Thymocyte B-cell antigen (ThB), Thb, Lymphocyte antigen 6D, Ly-6D, Ly6d, Ly61

Catalog No. TMPH-04484 Copy Product Info

LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$139	20 days	20 days
10 µg	$229	20 days	20 days
20 µg	$382	20 days	20 days
50 µg	$547	20 days	20 days
100 µg	$720	20 days	20 days
200 µg	$1,080	20 days	20 days
500 µg	$1,930	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	LY6D Protein, Mouse, Recombinant (mFc) is expressed in Yeast. The accession number is P35459.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	C-mFc
Accession Number	P35459
Amino Acid	LRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVS
Construction	21-98 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Thymocyte B-cell antigen (ThB), Thb, Lymphocyte antigen 6D, Ly-6D, Ly6d, Ly61

Chemical Properties

Molecular Weight

35.6 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 121 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.