LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO)

Name: LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-03085
Rating: 4.5 (1 reviews)

(Synonyms: Protein P2, Probable non-specific lipid-transfer protein 2, Major pollen allergen Par j 2.0101, LTP 2, Allergen Par j II) Copy Product Info

Synonyms: Protein P2, Probable non-specific lipid-transfer protein 2, Major pollen allergen Par j 2.0101, LTP 2, Allergen Par j II

Catalog No. TMPH-03085 Copy Product Info

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.3 kDa and the accession number is P55958.

LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.3 kDa and the accession number is P55958.
Species	Parietaria judaica
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P55958
Amino Acid	EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Construction	32-133 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Protein P2, Probable non-specific lipid-transfer protein 2, Major pollen allergen Par j 2.0101, LTP 2, Allergen Par j II
Research Background

Chemical Properties

Molecular Weight

27.3 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

LTP2Allergen Par jII

Related Tags: LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO) chemical structure | LTP2 Protein, Parietaria judaica, Recombinant (His & SUMO) molecular weight