Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LIPA Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01625

Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571.

LIPA Protein, Human, Recombinant (His)

LIPA Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01625
Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571.
Pack SizePriceAvailabilityQuantity
5 μg$12320 days
10 μg$19720 days
20 μg$33620 days
50 μg$49720 days
100 μg$69720 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP38571
Synonyms
Triacylglycerol lipase,Triacylglycerol ester hydrolase,Sterol esterase,Lysosomal acid lipase/cholesteryl ester hydrolase,Lipase A,LIPA,LAL,Diacylglycerol lipase,Cholesteryl esterase,Acid cholesteryl ester hydrolase
Amino Acid
SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Construction
22-399 aa
Protein Purity
> 90% as determined by SDS-PAGE.
LIPA Protein, Human, Recombinant (His)
Molecular Weight45.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords