LIPA Protein, Human, Recombinant (His)

Catalog No. TMPH-01625 Copy Product Info

Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571.

LIPA Protein, Human, Recombinant (His)

Catalog No. TMPH-01625

Copy Product Info

Pack Size	Price	USA Stock	Global Stock
5 μg	$123	20 days	20 days
10 μg	$197	20 days	20 days
20 μg	$336	20 days	20 days
50 μg	$497	20 days	20 days
100 μg	$697	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P38571
Synonyms	Triacylglycerol lipase,Triacylglycerol ester hydrolase,Sterol esterase,Lysosomal acid lipase/cholesteryl ester hydrolase,Lipase A,LIPA,LAL,Diacylglycerol lipase,Cholesteryl esterase,Acid cholesteryl ester hydrolase
Amino Acid	SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Construction	22-399 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	45.0 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol.