Shopping Cart
Remove All
Your shopping cart is currently empty
LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $377 | 20 days | 20 days | |
| 10 μg | $633 | 20 days | 20 days | |
| 20 μg | $1,070 | - | In Stock |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | Q14847 |
| Synonyms | MLN50,Metastatic lymph node gene 50 protein (MLN 50),LIM and SH3 domain protein 1,LASP-1,LASP1 |
| Amino Acid | MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI |
| Construction | 1-261 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 31.2 kDa (predicted); 43 kDa (reducing conditions) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.