Home Tools
Log in
Cart

LASP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-00003

LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
LASP1 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg In stock $ 1,070.00
Bulk Inquiry
Get quote
Select Batch  
Contact us for more batch information
Technical Params
Product Properties
Description LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.
Species Human
Expression System P. pastoris (Yeast)
Tag C-6xHis
Accession Number Q14847
Amino Acid MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Construction 1-261 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 31.2 kDa (predicted); 43 kDa (reducing conditions)
Formulation Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

LASP1 Protein, Human, Recombinant (His) RecombinantHumanLIMandSH3domainprotein1(LASP1) recombinant recombinant-proteins proteins protein

 

TargetMol