Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LASP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-00003

LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.

LASP1 Protein, Human, Recombinant (His)

LASP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-00003
LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.
Pack SizePriceAvailabilityQuantity
20 μg $1,070In Stock
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberQ14847
Synonyms
MLN50,Metastatic lymph node gene 50 protein (MLN 50),LIM and SH3 domain protein 1,LASP-1,LASP1
Amino Acid
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Construction
1-261 aa
Protein Purity
> 85% as determined by SDS-PAGE.
LASP1 Protein, Human, Recombinant (His)
Molecular Weight31.2 kDa (predicted); 43 kDa (reducing conditions)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords