Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

KRAS Protein, Human, Recombinant (G12S, GST)

Catalog No. TMPU-00001
KRAS Protein, Human, Recombinant (G12S, GST) is expressed in E. coli expression system with GST tag. The accession number is P01116.
Pack SizePriceAvailabilityQuantity
Bulk & Custom
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
A Homogeneous Time-Resolved Fluorescence (HTRF) based system was established for the protein-protein interaction between KRAS-G12S and its interacting protein SOS1. The positive compound, SOS1 inhibitor BI3406, exhibited an inhibitory activity (IC50) of approximately 18 nM, consistent with reported activities in the literature.
Description
KRAS Protein, Human, Recombinant (G12S, GST) is expressed in E. coli expression system with GST tag. The accession number is P01116.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberP01116
Synonyms
RASK2,RALD,NS3,NS,K-RAS4B,K-RAS4A,K-RAS2B,K-RAS2A,KRAS2,KRAS1,K-RAS,Kirsten rat sarcoma viral oncogene homolog,KI-RAS,C-K-RAS,CFC2
Amino Acid
MTEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Construction
A DNA sequence encoding the Human KRAS-G12S (uniprot# P01116) (Met1-Lys169) was expressed with a GST tag at the N-terminus
Protein Purity
>90% as determined by SDS-PAGE.
FormulationSupplied as a 0.2 μm filtered solution of 20 mM Hepes (PH=8.0), 150 mM NaCl, 1 mM DTT
Stability & Storage
It is recommended to store the product under sterile conditions at -20°C to -80°C. Samples are stable for up to 12 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingShipping with blue ice.
Research Background
K-Ras belongs to the small GTPase superfamily, Ras family. As other members of the Ras family, K-Ras is a GTPase and is an early player in many signal transduction pathways. It is usually tethered to cell membranes because of the presence of an isoprenyl group on its C-terminus. K-Ras functions as a molecular on/off switch. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner. Besides essential function in normal tissue signaling, the mutation of a K-Ras gene is an essential step in the development of many cancers. Several germline K-Ras mutations have been found to be associated with Noonan syndrome[4] and cardio-facio-cutaneous syndrome. Somatic K-Ras mutations are found at high rates in Leukemias, colon cancer, pancreatic cancer and lung cancer.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords