Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

KIR2DS3 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01589 Copy Product Info
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

KIR2DS3 Protein, Human, Recombinant (His)

Catalog No. TMPH-01589
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

KIR2DS3 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$58920 days20 days
200 μg$89020 days20 days
500 μg$1,62020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ14952
Synonyms
NKAT7,Natural killer-associated transcript 7 (NKAT-7),KIR2DS3,Killer cell immunoglobulin-like receptor 2DS3
Amino Acid
HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Construction
22-245 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight26.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords