Kallikrein 8 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02746 Copy Product Info

Kallikrein 8 Protein, Mouse, Recombinant (His) is expressed in Yeast.

Kallikrein 8 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02746

Copy Product Info

Kallikrein 8 Protein, Mouse, Recombinant (His) is expressed in Yeast.

Pack Size	Price	USA Stock	Global Stock
5 μg	$123	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$339	20 days	20 days
50 μg	$497	20 days	20 days
100 μg	$696	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Kallikrein 8 Protein, Mouse, Recombinant (His) is expressed in Yeast.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q61955
Synonyms	Serine protease 19,Prss19,Nrpn,Neuropsin (NP),mK8,Klk8,Kallikrein-8
Amino Acid	ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Construction	33-260 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	27.1 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.