Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02745 Copy Product Info
Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli.

Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His)

Catalog No. TMPH-02745
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli.

Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$105-In Stock
10 μg$169-In Stock
20 μg$283-In Stock
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli.
Species
Mouse
Expression System
E. coli
TagN-6xHis
Accession NumberQ61955
Synonyms
Serine protease 19,Prss19,Nrpn,Neuropsin (NP),mK8,Klk8,Kallikrein-8
Amino Acid
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Construction
33-260 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His)
Molecular Weight29.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords