Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

KAAG1 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03988

KAAG1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-10xHis. The accession number is Q9UBP8.

KAAG1 Protein, Human, Recombinant (His)

KAAG1 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03988
KAAG1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-10xHis. The accession number is Q9UBP8.
Pack SizePriceAvailabilityQuantity
5 μg$17520 days
10 μg$28920 days
20 μg$48820 days
50 μg$87720 days
100 μg$1,37020 days
200 μg$1,72020 days
500 μg$2,35020 days
1 mg$2,97020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 4.924-6.034 ng/mL.
Description
KAAG1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-10xHis. The accession number is Q9UBP8.
Species
Human
Expression System
Baculovirus Insect Cells
TagC-10xHis
Accession NumberQ9UBP8
Synonyms
RU2AS,RU2 antisense gene protein,Kidney-associated antigen 1,KAAG1
Amino Acid
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Construction
1-84 aa
Protein Purity
>90% as determined by SDS-PAGE.
Molecular Weight10.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords