Shopping Cart
- Remove All
- Your shopping cart is currently empty
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $515 | 20 days | |
100 μg | $916 | 20 days | |
1 mg | $2,690 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317. |
Species | Chicken |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P08317 |
Synonyms | Interleukin-8,IL-8,IL8,EMF1,Embryo fibroblast protein 1 (EMF-1),CXCL8,C-X-C motif chemokine 8,Chemokine (C-X-C motif) ligand 8,CEF-4,CEF4 |
Amino Acid | ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP |
Construction | 17-102 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 9.4 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.