Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-8/CXCL8 Protein, Chicken, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00376 Copy Product Info
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317.

IL-8/CXCL8 Protein, Chicken, Recombinant

Catalog No. TMPH-00376
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317.

IL-8/CXCL8 Protein, Chicken, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$18520 days20 days
10 μg$29720 days20 days
20 μg$51520 days20 days
50 μg$71320 days20 days
100 μg$91620 days20 days
200 μg$1,26020 days20 days
500 μg$1,93020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317.
Species
Chicken
Expression System
E. coli
TagTag Free
Accession NumberP08317
Synonyms
Interleukin-8,IL-8,IL8,EMF1,Embryo fibroblast protein 1 (EMF-1),CXCL8,C-X-C motif chemokine 8,Chemokine (C-X-C motif) ligand 8,CEF-4,CEF4
Amino Acid
ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP
Construction
17-102 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight9.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords