Shopping Cart
Remove All
Your shopping cart is currently empty
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $185 | 20 days | 20 days | |
| 10 μg | $297 | 20 days | 20 days | |
| 20 μg | $515 | 20 days | 20 days | |
| 50 μg | $713 | 20 days | 20 days | |
| 100 μg | $916 | 20 days | 20 days | |
| 200 μg | $1,260 | 20 days | 20 days | |
| 500 μg | $1,930 | 20 days | 20 days | |
| 1 mg | $2,690 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. IL-8/CXCL8 Protein, Chicken, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 9.4 kDa and the accession number is P08317. |
| Species | Chicken |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P08317 |
| Synonyms | Interleukin-8,IL-8,IL8,EMF1,Embryo fibroblast protein 1 (EMF-1),CXCL8,C-X-C motif chemokine 8,Chemokine (C-X-C motif) ligand 8,CEF-4,CEF4 |
| Amino Acid | ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP |
| Construction | 17-102 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 9.4 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.