Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-1RA Protein, Mouse, Recombinant (Active)

Catalog No. TMPH-04286

IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.

IL-1RA Protein, Mouse, Recombinant (Active)

IL-1RA Protein, Mouse, Recombinant (Active)

Catalog No. TMPH-04286
IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.
Pack SizePriceAvailabilityQuantity
100 μg$47820 days
500 μg$1,07020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg in the presence of 50 pg/ml rHuIL-1α.
Description
IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberP25085
Synonyms
IRAP,Interleukin-1 receptor antagonist protein,IL-1RN,Il1rn,Il-1ra,IL-1ra,IL1 inhibitor
Amino Acid
RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Construction
27-178 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight17.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords