Shopping Cart
Remove All
Your shopping cart is currently empty
IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $64 | - | In Stock | |
| 10 μg | $98 | - | In Stock | |
| 20 μg | $166 | 7-10 days | 7-10 days | |
| 50 μg | $322 | 7-10 days | 7-10 days | |
| 100 μg | $539 | 7-10 days | 7-10 days | |
| 200 μg | $763 | 7-10 days | 7-10 days | |
| 500 μg | $1,200 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg in the presence of 50 pg/ml rHuIL-1α. |
| Description | IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P25085 |
| Synonyms | IRAP,Interleukin-1 receptor antagonist protein,IL-1RN,Il1rn,Il-1ra,IL1 inhibitor |
| Amino Acid | RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ |
| Construction | 27-178 aa |
| Protein Purity | >97% as determined by SDS-PAGE. |
| Molecular Weight | 17.3 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.