IL-1RA Protein, Mouse, Recombinant (Active)

Name: IL-1RA Protein, Mouse, Recombinant (Active)
Brand: TargetMol
SKU: TMPH-04286
Price: 64 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: IRAP, Interleukin-1 receptor antagonist protein, IL-1RN, Il1rn, Il-1ra, IL1 inhibitor) Copy Product Info

Synonyms: IRAP, Interleukin-1 receptor antagonist protein, IL-1RN, Il1rn, Il-1ra, IL1 inhibitor

Catalog No. TMPH-04286 Copy Product Info

IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$64	-	In Stock
10 µg	$98	-	In Stock
20 µg	$166	7-10 days	7-10 days
50 µg	$322	7-10 days	7-10 days
100 µg	$539	7-10 days	7-10 days
200 µg	$763	7-10 days	7-10 days
500 µg	$1,200	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:> 97 % by SDS-PAGE and HPLC analyses.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of ＞ 2.0 × 104 IU/mg in the presence of 50 pg/ml rHuIL-1α.
Description	IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	P25085
Amino Acid	RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Construction	27-178 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	IRAP, Interleukin-1 receptor antagonist protein, IL-1RN, Il1rn, Il-1ra, IL1 inhibitor

Chemical Properties

Molecular Weight

17.3 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.