IL-1RA Protein, Mouse, Recombinant (Active)

Catalog No. TMPH-04286

IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.

IL-1RA Protein, Mouse, Recombinant (Active)

Catalog No. TMPH-04286

IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.

Pack Size	Price	Availability
5 μg	$64	In Stock
10 μg	$98	In Stock
20 μg	$166	7-10 days
50 μg	$322	7-10 days
100 μg	$539	7-10 days
200 μg	$763	7-10 days
500 μg	$1,200	7-10 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of ＞ 2.0 × 104 IU/mg in the presence of 50 pg/ml rHuIL-1α.
Description	IL-1RA Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P25085.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	P25085
Synonyms	IRAP,Interleukin-1 receptor antagonist protein,IL-1RN,Il1rn,Il-1ra,IL-1ra,IL1 inhibitor
Amino Acid	RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Construction	27-178 aa
Protein Purity	>97% as determined by SDS-PAGE.
Molecular Weight	17.3 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.