Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-11 Protein, Rat, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04424

IL-11 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q99MF5.

IL-11 Protein, Rat, Recombinant (hFc)

IL-11 Protein, Rat, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04424
IL-11 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q99MF5.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$7520 days20 days
10 μg$11820 days20 days
20 μg$19720 days20 days
50 μg$28720 days20 days
100 μg$38320 days20 days
200 μg$68620 days20 days
500 μg$1,57020 days20 days
1 mg$2,90020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IL-11 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q99MF5.
Species
Rat
Expression System
HEK293 Cells
TagC-hFc
Accession NumberQ99MF5
Synonyms
Interleukin-11,IL-11,Il11
Amino Acid
PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Construction
22-199 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight48.1 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 61 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords