IL-11 Protein, Rat, Recombinant (hFc)

Name: IL-11 Protein, Rat, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-04424
Rating: 4.5 (1 reviews)

(Synonyms: Interleukin-11, IL-11, Il11) Copy Product Info

Synonyms: Interleukin-11, IL-11, Il11

Catalog No. TMPH-04424 Copy Product Info

IL-11 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q99MF5.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$118	20 days	20 days
20 µg	$197	20 days	20 days
50 µg	$287	20 days	20 days
100 µg	$383	20 days	20 days
200 µg	$686	20 days	20 days
500 µg	$1,570	20 days	20 days
1 mg	$2,900	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IL-11 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q99MF5.
Species	Rat
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q99MF5
Amino Acid	PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Construction	22-199 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Interleukin-11, IL-11, Il11

Chemical Properties

Molecular Weight

48.1 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 61 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.