IGFLR1 Protein, Human, Recombinant (His)

Name: IGFLR1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01515
Rating: 4.5 (1 reviews)

(Synonyms: U2AF1L4, U2 small nuclear RNA auxiliary factor 1-like 4, Transmembrane protein 149, TMEM149, IGFLR1, IGF-like family receptor 1) Copy Product Info

Synonyms: U2AF1L4, U2 small nuclear RNA auxiliary factor 1-like 4, Transmembrane protein 149, TMEM149, IGFLR1, IGF-like family receptor 1

Catalog No. TMPH-01515 Copy Product Info

Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.

IGFLR1 Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$50	20 days	20 days
10 μg	$79	20 days	20 days
20 μg	$127	20 days	20 days
50 μg	$225	20 days	20 days
100 μg	$350	20 days	20 days
200 μg	$633	20 days	20 days
500 μg	$1,390	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1, the EC 50 is 32.33-47.52 ng/mL.
Description	Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Species	Human
Expression System	HEK293 Cells
Tag	C-6xHis
Accession Number	Q9H665
Amino Acid	SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Construction	23-163 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	U2AF1L4, U2 small nuclear RNA auxiliary factor 1-like 4, Transmembrane protein 149, TMEM149, IGFLR1, IGF-like family receptor 1
Research Background

Chemical Properties

Molecular Weight

17.4 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

U2AF1L 4TMEM 149IGFLR 1

Related Tags: IGFLR1 Protein, Human, Recombinant (His) chemical structure | IGFLR1 Protein, Human, Recombinant (His) molecular weight