Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IGF1/IGF-I Protein, Bovine, Recombinant (hFc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00273 Copy Product Info
IGF1/IGF-I Protein, Bovine, Recombinant (hFc) is expressed in yeast with N-hFc tag. The predicted molecular weight is 34.3 kDa and the accession number is P07455.

IGF1/IGF-I Protein, Bovine, Recombinant (hFc)

Catalog No. TMPH-00273
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

IGF1/IGF-I Protein, Bovine, Recombinant (hFc) is expressed in yeast with N-hFc tag. The predicted molecular weight is 34.3 kDa and the accession number is P07455.

IGF1/IGF-I Protein, Bovine, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$9520 days20 days
10 μg$15520 days20 days
20 μg$25620 days20 days
50 μg$38620 days20 days
100 μg$52820 days20 days
200 μg$81720 days20 days
500 μg$1,46020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IGF1/IGF-I Protein, Bovine, Recombinant (hFc) is expressed in yeast with N-hFc tag. The predicted molecular weight is 34.3 kDa and the accession number is P07455.
Species
Bovine
Expression System
P. pastoris (Yeast)
TagN-hFc
Accession NumberP07455
Synonyms
Somatomedin,Insulin-like growth factor I (IGF-I),Insulin-like growth factor 1,IGF-1,IGF1
Amino Acid
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Construction
50-119 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight34.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords