IGF1/IGF-I Protein, Chicken, Recombinant (hFc)

Name: IGF1/IGF-I Protein, Chicken, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-04757
Price: 106 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Somatomedin, Insulin-like growth factor I (IGF-I), Insulin-like growth factor 1, IGF-1, IGF1) Copy Product Info

Synonyms: Somatomedin, Insulin-like growth factor I (IGF-I), Insulin-like growth factor 1, IGF-1, IGF1

Catalog No. TMPH-04757 Copy Product Info

Purity: 97%

IGF1/IGF-I Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P18254.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$106	-	In Stock
10 µg	$172	-	In Stock
20 µg	$286	-	In Stock
50 µg	$397	20 days	20 days
100 µg	$535	20 days	20 days
200 µg	$837	20 days	20 days
500 µg	$1,520	20 days	20 days
1 mg	$2,390	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:97%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IGF1/IGF-I Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P18254.
Species	Chicken
Expression System	P. pastoris (Yeast)
Tag	N-hFc
Accession Number	P18254
Amino Acid	GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
Construction	49-118 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Somatomedin, Insulin-like growth factor I (IGF-I), Insulin-like growth factor 1, IGF-1, IGF1

Chemical Properties

Molecular Weight

34.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 394 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.