Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IGF1/IGF-I Protein, Chicken, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04757 Copy Product Info
IGF1/IGF-I Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P18254.

IGF1/IGF-I Protein, Chicken, Recombinant (hFc)

Catalog No. TMPH-04757
Copy Product Info
TargetMol | SPR

IGF1/IGF-I Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P18254.

IGF1/IGF-I Protein, Chicken, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$106-In Stock
10 μg$172-In Stock
20 μg$286-In Stock
50 μg$39720 days20 days
100 μg$53520 days20 days
200 μg$83720 days20 days
500 μg$1,52020 days20 days
1 mg$2,39020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IGF1/IGF-I Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P18254.
Species
Chicken
Expression System
P. pastoris (Yeast)
TagN-hFc
Accession NumberP18254
Synonyms
Somatomedin,Insulin-like growth factor I (IGF-I),Insulin-like growth factor 1,IGF-1,IGF1
Amino Acid
GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
Construction
49-118 aa
Protein Purity
> 95% as determined by SDS-PAGE.
IGF1/IGF-I Protein, Chicken, Recombinant (hFc)
Molecular Weight34.4 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 394 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.