Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Somatomedin, Insulin-like growth factor I (IGF-I), Insulin-like growth factor 1, IGF-1, IGF1


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $106 | - | In Stock | |
| 10 µg | $172 | - | In Stock | |
| 20 µg | $286 | - | In Stock | |
| 50 µg | $397 | 20 days | 20 days | |
| 100 µg | $535 | 20 days | 20 days | |
| 200 µg | $837 | 20 days | 20 days | |
| 500 µg | $1,520 | 20 days | 20 days | |
| 1 mg | $2,390 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | IGF1/IGF-I Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P18254. |
| Species | Chicken |
| Expression System | P. pastoris (Yeast) |
| Tag | N-hFc |
| Accession Number | P18254 |
| Amino Acid | GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA |
| Construction | 49-118 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. ![]() |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Somatomedin, Insulin-like growth factor I (IGF-I), Insulin-like growth factor 1, IGF-1, IGF1 |
| Molecular Weight | 34.4 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 394 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.