Shopping Cart
Remove All
Your shopping cart is currently empty
IFNLR1 Protein, Human, Recombinant
Catalog No. TMPH-03981 Copy Product Info
IFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57.
IFNLR1 Protein, Human, Recombinant
Catalog No. TMPH-03981
Copy Product InfoIFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $142 | 20 days | 20 days | |
| 10 μg | $235 | 20 days | 20 days | |
| 20 μg | $392 | 20 days | 20 days | |
| 50 μg | $493 | 20 days | 20 days | |
| 100 μg | $589 | 20 days | 20 days | |
| 200 μg | $847 | 20 days | 20 days | |
| 500 μg | $1,370 | 20 days | 20 days | |
| 1 mg | $1,980 | 20 days | 20 days |
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | IFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q8IU57 |
| Synonyms | Likely interleukin or cytokine receptor 2 (LICR2),LICR2,Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA),Interferon lambda receptor 1,IL28RA,IFNLR1,IFN-lambda-R1,IFN-lambda receptor 1,Cytokine receptor family 2 member 12 (CRF2-12),Cytokine receptor class-II member 12 |
| Amino Acid | RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA |
| Construction | 21-228 aa |
| Protein Purity | >85% as determined by SDS-PAGE. |
| Molecular Weight | 23.6 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Keywords
LICR 2Interleukin-28 receptor subunit α (IL-28 receptor subunit α;IL-28R-α;IL-28RA)Interleukin-28 receptor subunit a (IL-28 receptor subunit a;IL-28R-a;IL-28RA)Interferon λ receptor 1IL28R-αIL-28R-αIL28R-alphaIL-28R-alphaIL28R-aIL-28R-aIFN-λ-R1IFN-λ receptor 1IFNλ R1IFNLR 1IFN λ R1IFN lambda R1CRF2-12CRF212
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.