IFNLR1 Protein, Human, Recombinant

Name: IFNLR1 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-03981
Rating: 4.5 (1 reviews)

(Synonyms: Likely interleukin or cytokine receptor 2 (LICR2), LICR2, Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA), Interferon lambda receptor 1, IL28RA, IFNLR1, IFN-lambda-R1, IFN-lambda receptor 1, Cytokine receptor family 2 member 12 (CRF2-12), Cytokine receptor class-II member 12) Copy Product Info

Synonyms: Likely interleukin or cytokine receptor 2 (LICR2), LICR2, Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA), Interferon lambda receptor 1, IL28RA, IFNLR1, IFN-lambda-R1, IFN-lambda receptor 1, Cytokine receptor family 2 member 12 (CRF2-12), Cytokine receptor class-II member 12

Catalog No. TMPH-03981 Copy Product Info

IFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$142	20 days	20 days
10 µg	$235	20 days	20 days
20 µg	$392	20 days	20 days
50 µg	$493	20 days	20 days
100 µg	$589	20 days	20 days
200 µg	$847	20 days	20 days
500 µg	$1,370	20 days	20 days
1 mg	$1,980	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	IFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	Q8IU57
Amino Acid	RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
Construction	21-228 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Likely interleukin or cytokine receptor 2 (LICR2), LICR2, Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA), Interferon lambda receptor 1, IL28RA, IFNLR1, IFN-lambda-R1, IFN-lambda receptor 1, Cytokine receptor family 2 member 12 (CRF2-12), Cytokine receptor class-II member 12

Chemical Properties

Molecular Weight

23.6 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.