Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Likely interleukin or cytokine receptor 2 (LICR2), LICR2, Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA), Interferon lambda receptor 1, IL28RA, IFNLR1, IFN-lambda-R1, IFN-lambda receptor 1, Cytokine receptor family 2 member 12 (CRF2-12), Cytokine receptor class-II member 12


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $142 | 20 days | 20 days | |
| 10 µg | $235 | 20 days | 20 days | |
| 20 µg | $392 | 20 days | 20 days | |
| 50 µg | $493 | 20 days | 20 days | |
| 100 µg | $589 | 20 days | 20 days | |
| 200 µg | $847 | 20 days | 20 days | |
| 500 µg | $1,370 | 20 days | 20 days | |
| 1 mg | $1,980 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | IFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q8IU57 |
| Amino Acid | RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA |
| Construction | 21-228 aa |
| Protein Purity | >85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Likely interleukin or cytokine receptor 2 (LICR2), LICR2, Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA), Interferon lambda receptor 1, IL28RA, IFNLR1, IFN-lambda-R1, IFN-lambda receptor 1, Cytokine receptor family 2 member 12 (CRF2-12), Cytokine receptor class-II member 12 |
| Molecular Weight | 23.6 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.