Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

IFNAR1 Protein, M. auratus, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04516

IFNAR1 Protein, M. auratus, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A3Q0CXY4.

IFNAR1 Protein, M. auratus, Recombinant (His)

IFNAR1 Protein, M. auratus, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04516
IFNAR1 Protein, M. auratus, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A3Q0CXY4.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23820 days
20 μg$39720 days
50 μg$72620 days
100 μg$1,15020 days
200 μg$1,77020 days
500 μg$3,13020 days
1 mg$4,83020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IFNAR1 Protein, M. auratus, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A3Q0CXY4.
Species
Mesocricetus auratus (Golden hamster)
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberA0A3Q0CXY4
Synonyms
Ifnar1
Amino Acid
DGEELEPPEDVDVYIVDDNLTLKWSHKGEPAGNVTFSAEYQTDEMENWLKLPGCHHVTGTECEFSLLNTNIYAEMKFRVRAETGKSTSSWAEVDPFIPFLRAHIGPPGVRLEAEDQAIVVDISYPGRGGKMWEGDTLRFQYRIVIWQRSSNETKTITTSYYTIKISKLLPETTYCLKVKAIHTFRGKHSNYSAVQCINTTEASKMPVPENIEMDALGESYVLRWDCAPADVSFRAQWLPNFYKSTSGSSPDKWKPIPACADIRTMQCVFPRNTIHTDHFLLRVQAFRGNNTSFWSEEKLINSQKYTKIPPPIVAVTPTRDSLLVYVSCQDHSLSKCRKLTYEVVFWDKTSNTKRRVVKESPEFTIENLQPQTVYCVQARVLSFATWNKSSDFSDALCDATRPGNSSS
Construction
25-431 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight47.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 153 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.