Home Tools
Log in
Cart

Hyaluronidase Protein, Vespa magnifica, Recombinant (His)

Catalog No. TMPH-03700

Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides. Hyaluronidase Protein, Vespa magnifica, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P86875.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Hyaluronidase Protein, Vespa magnifica, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides. Hyaluronidase Protein, Vespa magnifica, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P86875.
Species Vespa magnifica
Expression System E. coli
Tag N-6xHis
Accession Number P86875
Amino Acid SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDNFQGDKIAIFYDPGEFPALLPLNYGKYKIRNGGVPQEGNITIHLQRFIEYLDKTYPNRNFSGIGVIDFERWRPIFRQNWGNMKIYKNFSIDLVRKEHPFWNKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFNMSPTNFVPDCDVTARDENNEMSWLFNNQNVLLPSVYIRRELTPDQRIGLVQGRVKEAVRISNKLKHSPKVFSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSSDVNSLSKCTRLREYLLTVLGPIAVNVTEAVN
Construction 27-357 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 45.1 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol