Shopping Cart
Remove All
Your shopping cart is currently empty
HSD11B2 Protein, Human, Recombinant (His)
(Synonyms: Short chain dehydrogenase/reductase family 9C member 3, SDR9C3, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, HSD11K, HSD11B2, Corticosteroid 11-beta-dehydrogenase isozyme 2, 11-DH2, 11-beta-hydroxysteroid dehydrogenase type II (11-HSD type II;11-beta-HSD type II), 11-beta-hydroxysteroid dehydrogenase type 2, 11-beta-HSD2) Copy Product InfoSynonyms: Short chain dehydrogenase/reductase family 9C member 3, SDR9C3, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, HSD11K, HSD11B2, Corticosteroid 11-beta-dehydrogenase isozyme 2, 11-DH2, 11-beta-hydroxysteroid dehydrogenase type II (11-HSD type II;11-beta-HSD type II), 11-beta-hydroxysteroid dehydrogenase type 2, 11-beta-HSD2
Catalog No. TMPH-00844 Copy Product Info
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. HSD11B2 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is P80365.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $86 | - | In Stock | |
| 10 μg | $138 | - | In Stock | |
| 20 μg | $231 | 20 days | 20 days | |
| 50 μg | $348 | 20 days | 20 days | |
| 100 μg | $480 | - | In Stock | |
| 200 μg | $743 | 20 days | 20 days | |
| 500 μg | $1,330 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:Greater than 90% as determined by SDS-PAGE.
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. HSD11B2 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 46.1 kDa and the accession number is P80365. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P80365 |
| Amino Acid | MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR |
| Construction | 1-405 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Short chain dehydrogenase/reductase family 9C member 3, SDR9C3, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, HSD11K, HSD11B2, Corticosteroid 11-beta-dehydrogenase isozyme 2, 11-DH2, 11-beta-hydroxysteroid dehydrogenase type II (11-HSD type II;11-beta-HSD type II), 11-beta-hydroxysteroid dehydrogenase type 2, 11-beta-HSD2 |
| Research Background |
| Molecular Weight | 46.1 kDa (predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
SDR9C 3NAD-dependent 11-β-hydroxysteroid dehydrogenaseNAD-dependent 11-b-hydroxysteroid dehydrogenaseHSD11B 2Corticosteroid 11-β-dehydrogenase isozyme 2Corticosteroid 11-b-dehydrogenase isozyme 211-β-hydroxysteroid dehydrogenase type II (11-HSD type II;11-β-HSD type II)11-β-hydroxysteroid dehydrogenase type 211β-HSD211-β-HSD211βHSD211β HSD211-HSD type II11HSD type II11-DH-211-b-hydroxysteroid dehydrogenase type II (11-HSD type II;11-b-HSD type II)11-b-hydroxysteroid dehydrogenase type 211-b-HSD211bHSD211beta HSD211b HSD2
Preview
Related Tags: HSD11B2 Protein, Human, Recombinant (His) chemical structure | HSD11B2 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.