Shopping Cart
- Remove All
- Your shopping cart is currently empty
HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $89 | 20 days | |
10 μg | $143 | 20 days | |
20 μg | $237 | 20 days | |
50 μg | $358 | 20 days | |
100 μg | $490 | 20 days | |
200 μg | $755 | 20 days | |
500 μg | $1,330 | 20 days | |
1 mg | $2,080 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/mL can bind human HP_0175 with a linear range of 31.25-600.00 ng/mL. |
Description | HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112. |
Species | Helicobacter pylori |
Expression System | E. coli |
Tag | N-GST |
Accession Number | P56112 |
Synonyms | Rotamase HP_0175,Putative peptidyl-prolyl cis-trans isomerase HP_0175,PPIase HP_0175 |
Amino Acid | KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK |
Construction | 22-299 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 58.8 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | N/A |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.