HP-0175 Protein, Helicobacter pylori, Recombinant (GST)

Catalog No. TMPH-00798

HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.

HP-0175 Protein, Helicobacter pylori, Recombinant (GST)

Catalog No. TMPH-00798

HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.

Pack Size	Price	Availability
5 μg	$89	20 days
10 μg	$143	20 days
20 μg	$237	20 days
50 μg	$358	20 days
100 μg	$490	20 days
200 μg	$755	20 days
500 μg	$1,330	20 days
1 mg	$2,080	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/mL can bind human HP_0175 with a linear range of 31.25-600.00 ng/mL.
Description	HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.
Species	Helicobacter pylori
Expression System	E. coli
Tag	N-GST
Accession Number	P56112
Synonyms	Rotamase HP_0175,Putative peptidyl-prolyl cis-trans isomerase HP_0175,PPIase HP_0175
Amino Acid	KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK
Construction	22-299 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	58.8 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	N/A