Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

HP-0175 Protein, Helicobacter pylori, Recombinant (GST)

Catalog No. TMPH-00798

HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.

HP-0175 Protein, Helicobacter pylori, Recombinant (GST)

HP-0175 Protein, Helicobacter pylori, Recombinant (GST)

Catalog No. TMPH-00798
HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.
Pack SizePriceAvailabilityQuantity
20 μg$23720 days
100 μg$49020 days
1 mg$2,08020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/mL can bind human HP_0175 with a linear range of 31.25-600.00 ng/mL.
Description
HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.
Species
Helicobacter pylori
Expression System
E. coli
TagN-GST
Accession NumberP56112
Synonyms
Rotamase HP_0175,Putative peptidyl-prolyl cis-trans isomerase HP_0175,PPIase HP_0175
Amino Acid
KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK
Construction
22-299 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight58.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords