Shopping Cart
Remove All
Your shopping cart is currently empty
HP-0175 Protein, Helicobacter pylori, Recombinant (GST)
Catalog No. TMPH-00798 Copy Product Info
HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.
HP-0175 Protein, Helicobacter pylori, Recombinant (GST)
Catalog No. TMPH-00798
Copy Product InfoHP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $89 | 20 days | 20 days | |
| 10 μg | $143 | 20 days | 20 days | |
| 20 μg | $237 | 20 days | 20 days | |
| 50 μg | $358 | 20 days | 20 days | |
| 100 μg | $490 | 20 days | 20 days | |
| 200 μg | $755 | 20 days | 20 days | |
| 500 μg | $1,330 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/mL can bind human HP_0175 with a linear range of 31.25-600.00 ng/mL. |
| Description | HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112. |
| Species | Helicobacter pylori |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | P56112 |
| Synonyms | Rotamase HP_0175,Putative peptidyl-prolyl cis-trans isomerase HP_0175,PPIase HP_0175 |
| Amino Acid | KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK |
| Construction | 22-299 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 58.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | N/A |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Keywords
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.