Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

HIV-2 (subtype A, isolate BEN) Protein Vpx (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01521

HIV-2 (subtype A, isolate BEN) Protein Vpx (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.2 kDa and the accession number is P18099.

HIV-2 (subtype A, isolate BEN) Protein Vpx (His)

HIV-2 (subtype A, isolate BEN) Protein Vpx (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01521
HIV-2 (subtype A, isolate BEN) Protein Vpx (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.2 kDa and the accession number is P18099.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HIV-2 (subtype A, isolate BEN) Protein Vpx (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.2 kDa and the accession number is P18099.
Species
HIV-2
Expression System
E. coli
TagN-6xHis
Accession NumberP18099
Synonyms
X ORF protein,vpx,Viral protein X,Protein Vpx
Amino Acid
MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV
Construction
1-113 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight17.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords