Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

HDT2 Protein, Arabidopsis thaliana, Recombinant (His)

Catalog No. TMPH-00095

Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDT2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.3 kDa and the accession number is Q56WH4.

HDT2 Protein, Arabidopsis thaliana, Recombinant (His)

HDT2 Protein, Arabidopsis thaliana, Recombinant (His)

Catalog No. TMPH-00095
Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDT2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.3 kDa and the accession number is Q56WH4.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$84520 days
500 μg$1,95020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDT2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.3 kDa and the accession number is Q56WH4.
Species
Arabidopsis thaliana
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ56WH4
Synonyms
Histone deacetylase HDT2,Histone deacetylase 2b,HD-tuins protein 2,HDT2,HDA4,HD2B,HD2
Amino Acid
MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA
Construction
1-306 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight34.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords