GSTA1 Protein, Rat, Recombinant (His & SUMO)

Name: GSTA1 Protein, Rat, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-03305
Rating: 4.5 (1 reviews)

(Synonyms: Ligandin, Gsta1, GST B, GST A1-1, GST 1a-1a, GST 1-1, Glutathione S-transferase Ya-1 (GST Ya1), Glutathione S-transferase alpha-1, Androst-5-ene-3,17-dione isomerase, 13-hydroperoxyoctadecadienoate peroxidase) Copy Product Info

Synonyms: Ligandin, Gsta1, GST B, GST A1-1, GST 1a-1a, GST 1-1, Glutathione S-transferase Ya-1 (GST Ya1), Glutathione S-transferase alpha-1, Androst-5-ene-3,17-dione isomerase, 13-hydroperoxyoctadecadienoate peroxidase

Catalog No. TMPH-03305 Copy Product Info

GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli.
Species	Rat
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P00502
Amino Acid	SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Construction	2-222 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Ligandin, Gsta1, GST B, GST A1-1, GST 1a-1a, GST 1-1, Glutathione S-transferase Ya-1 (GST Ya1), Glutathione S-transferase alpha-1, Androst-5-ene-3,17-dione isomerase, 13-hydroperoxyoctadecadienoate peroxidase
Research Background	Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). It also catalyzes the isomerization of D5-androstene-3,17-dione (AD) into D4-androstene-3,17-dione and may therefore play an important role in hormone biosynthesis. Through its glutathione-dependent peroxidase activity toward the fatty acid hydroperoxide (13S)-hydroperoxy-(9Z,11E)-octadecadienoate/13-HPODE it is also involved in the metabolism of oxidized linoleic acid.

Chemical Properties

Molecular Weight

41.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.