GIPR Protein, Mouse, Recombinant (His)

Catalog No. TMPH-04274 Copy Product Info

GIPR Protein, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q0P543.

GIPR Protein, Mouse, Recombinant (His)

Catalog No. TMPH-04274

Copy Product Info

GIPR Protein, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q0P543.

Pack Size	Price	USA Stock	Global Stock
5 μg	$50	20 days	20 days
10 μg	$79	20 days	20 days
20 μg	$127	20 days	20 days
50 μg	$213	20 days	20 days
100 μg	$319	20 days	20 days
200 μg	$576	20 days	20 days
500 μg	$1,270	20 days	20 days
1 mg	$2,320	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml.
Description	GIPR Protein, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q0P543.
Species	Mouse
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	Q0P543
Synonyms	Glucose-dependent insulinotropic polypeptide receptor,GIP-R,Gipr,Gastric inhibitory polypeptide receptor
Amino Acid	ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Construction	19-134 aa
Protein Purity	>95% as determined by SDS-PAGE.
Molecular Weight	14.7 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.