Shopping Cart
- Remove All
Your shopping cart is currently empty
GIPR Protein, Mouse, Recombinant (His)
Catalog No. TMPH-04274
GIPR Protein, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q0P543.
GIPR Protein, Mouse, Recombinant (His)
Catalog No. TMPH-04274
GIPR Protein, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q0P543.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $50 | 20 days | |
| 10 μg | $79 | 20 days | |
| 20 μg | $127 | 20 days | |
| 50 μg | $213 | 20 days | |
| 100 μg | $319 | 20 days | |
| 200 μg | $576 | 20 days | |
| 500 μg | $1,270 | 20 days | |
| 1 mg | $2,320 | 20 days |
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml. |
| Description | GIPR Protein, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q0P543. |
| Species | Mouse |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | Q0P543 |
| Synonyms | Glucose-dependent insulinotropic polypeptide receptor,GIP-R,Gipr,Gastric inhibitory polypeptide receptor |
| Amino Acid | ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ |
| Construction | 19-134 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 14.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Sci Citations
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.