Shopping Cart
- Remove All
- Your shopping cart is currently empty
GDF-7 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q7Z4P5.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $197 | 20 days | |
10 μg | $328 | 20 days | |
20 μg | $552 | 20 days | |
50 μg | $1,080 | 20 days | |
100 μg | $1,880 | 20 days | |
200 μg | $2,660 | 20 days | |
500 μg | $4,230 | 20 days |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
Description | GDF-7 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q7Z4P5. |
Species | Human |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | Q7Z4P5 |
Synonyms | Growth/differentiation factor 7,GDF-7,GDF7 |
Amino Acid | TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Construction | 322-450 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 14.0 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.