Shopping Cart
Remove All
Your shopping cart is currently empty
GDF-6 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6KF10.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $92 | 7-10 days | 7-10 days | |
| 10 μg | $147 | 7-10 days | 7-10 days | |
| 20 μg | $223 | 7-10 days | 7-10 days | |
| 50 μg | $393 | 7-10 days | 7-10 days | |
| 100 μg | $613 | 7-10 days | 7-10 days | |
| 200 μg | $857 | 7-10 days | 7-10 days | |
| 500 μg | $1,330 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg. |
| Description | GDF-6 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6KF10. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q6KF10 |
| Synonyms | Growth/differentiation factor 6,Growth/differentiation factor 16,GDF-6,GDF6,GDF16,Bone morphogenetic protein 13 (BMP-13),BMP13 |
| Amino Acid | TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR |
| Construction | 336-455 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 13.6 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.