Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

GBA2 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03342

GBA2 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 42.6 kDa and the accession number is Q5M868.

GBA2 Protein, Rat, Recombinant (His)

GBA2 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03342
GBA2 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 42.6 kDa and the accession number is Q5M868.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
GBA2 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 42.6 kDa and the accession number is Q5M868.
Species
Rat
Expression System
E. coli
TagC-6xHis
Accession NumberQ5M868
Synonyms
Non-lysosomal glycosylceramidase,Non-lysosomal glucosylceramidase,Non-lysosomal galactosylceramidase,Non-lysosomal cholesterol glycosyltransferase,NLGase,Glucosylceramidase 2,Gba2,Cholesteryl-beta-glucosidase GBA2,Cholesterol glucosyltransferase GBA2,Bile acid glucosyl transferase GBA2,Bile acid beta-glucosidase GBA2,Beta-glucocerebrosidase 2 (Beta-glucosidase 2)
Amino Acid
GRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERLLWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALKTIFELNVQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAM
Construction
512-877 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight42.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Non-lysosomal glucosylceramidase that catalyzes the hydrolysis of glucosylceramide (GlcCer) to free glucose and ceramide. Glucosylceramides are membrane glycosphingolipids that have a wide intracellular distribution. They are the main precursors of more complex glycosphingolipids that play a role in cellular growth, differentiation, adhesion, signaling, cytoskeletal dynamics and membrane properties. Also involved in the transglucosylation of cholesterol, transferring glucose from glucosylceramides, thereby modifying its water solubility and biological properties. Under specific conditions, may catalyze the reverse reaction, transferring glucose from cholesteryl-beta-D-glucoside to ceramide. Finally, may also play a role in the metabolism of bile acids. It is able to hydrolyze bile acid 3-O-glucosides but also to produce bile acid-glucose conjugates thanks to a bile acid glucosyl transferase activity. However, the relevance of both activities is unclear in vivo.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords