Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

GABARAPL2 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPY-03461 Copy Product Info
GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

GABARAPL2 Protein, Human, Recombinant (His)

Catalog No. TMPY-03461
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

GABARAPL2 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$487-10 days7-10 days
10 μg$767-10 days7-10 days
20 μg$1187-10 days7-10 days
50 μg$2377-10 days7-10 days
100 μg$4587-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
Species
Human
Expression System
E. coli
TagN-His
Accession NumberP60520
Synonyms
GEF-2,GEF2,GATE-16,GATE16,GABA(A) receptor-associated protein-like 2,ATG8C,ATG8
Amino Acid
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Construction
1-117 aa
Protein Purity
> 90% as determined by SDS-PAGE
Molecular Weight14.6 kDa (predicted)
EndotoxinPlease contact us for more information.
FormulationTris/PBS-based buffer
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords