GABARAPL2 Protein, Human, Recombinant (His)

Name: GABARAPL2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPY-03461
Rating: 4.5 (1 reviews)

(Synonyms: GEF-2, GEF2, GATE-16, GATE16, GABA(A) receptor-associated protein-like 2, ATG8C, ATG8) Copy Product Info

Synonyms: GEF-2, GEF2, GATE-16, GATE16, GABA(A) receptor-associated protein-like 2, ATG8C, ATG8

Catalog No. TMPY-03461 Copy Product Info

GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

GABARAPL2 Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$48	7-10 days	7-10 days
10 µg	$76	7-10 days	7-10 days
20 µg	$118	7-10 days	7-10 days
50 µg	$237	7-10 days	7-10 days
100 µg	$458	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
Species	Human
Expression System	E. coli
Tag	N-His
Accession Number	P60520
Amino Acid	MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Construction	1-117 aa
Protein Purity	> 90% as determined by SDS-PAGE
Endotoxin	Please contact us for more information.
Formulation	Tris/PBS-based buffer
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	GEF-2, GEF2, GATE-16, GATE16, GABA(A) receptor-associated protein-like 2, ATG8C, ATG8
Research Background	GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Chemical Properties

Molecular Weight

14.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.