Shopping Cart
- Remove All
Your shopping cart is currently empty
Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity. FtsZ Protein, S. aureus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P0A031.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $129 | 20 days | |
| 10 μg | $216 | 20 days | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity. FtsZ Protein, S. aureus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P0A031. |
| Species | Staphylococcus aureus |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P0A031 |
| Synonyms | ftsZ,Cell division protein FtsZ |
| Amino Acid | MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDSVSERTHTTKEDDIPSFIRNREERRSRRTRR |
| Construction | 1-390 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 45.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.