Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FtnA Protein, Helicobacter pylori, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00792 Copy Product Info
Iron-storage protein.

FtnA Protein, Helicobacter pylori, Recombinant (His)

Catalog No. TMPH-00792
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Iron-storage protein.

FtnA Protein, Helicobacter pylori, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$17620 days20 days
10 μg$29220 days20 days
20 μg$48920 days20 days
50 μg$92320 days20 days
100 μg$1,50020 days20 days
200 μg$1,89020 days20 days
500 μg$2,58020 days20 days
1 mg$3,26020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Iron-storage protein.
Species
Helicobacter pylori
Expression System
Baculovirus Insect Cells
TagN-10xHis
Accession NumberP52093
Synonyms
pfr,ftnA,Bacterial non-heme ferritin
Amino Acid
MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Construction
1-167 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight21.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Iron-storage protein.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.