Home Tools
Log in
Cart

Fragilysin Protein, Bacteroides fragilis, Recombinant (His)

Catalog No. TMPH-00190

Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen. Fragilysin Protein, Bacteroides fragilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 46.7 kDa and the accession number is P54355.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Fragilysin Protein, Bacteroides fragilis, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen. Fragilysin Protein, Bacteroides fragilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 46.7 kDa and the accession number is P54355.
Species Bacteroides fragilis
Expression System E. coli
Tag N-6xHis
Accession Number P54355
Amino Acid ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD
Construction 26-405 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 46.7 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol