Shopping Cart
- Remove All
- Your shopping cart is currently empty
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $284 | 20 days | |
100 μg | $590 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. |
Species | Mouse |
Expression System | E. coli |
Tag | N-6xHis-SUMO |
Accession Number | A1KXC4 |
Synonyms | Toso,Regulator of Fas-induced apoptosis Toso,Immunoglobulin mu Fc receptor,IgM FcR,Fcmr,Fas apoptotic inhibitory molecule 3 (FAIM3),Faim3 |
Amino Acid | RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPE |
Construction | 18-262 |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 43.9 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.