Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Endonuclease V Protein, T. neapolitana, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04376

Endonuclease V Protein, T. neapolitana, Recombinant (His) is expressed in Yeast. The accession number is B9K7P3.

Endonuclease V Protein, T. neapolitana, Recombinant (His)

Endonuclease V Protein, T. neapolitana, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04376
Endonuclease V Protein, T. neapolitana, Recombinant (His) is expressed in Yeast. The accession number is B9K7P3.
Pack SizePriceAvailabilityQuantity
5 μg$9620 days
10 μg$15620 days
20 μg$25920 days
50 μg$36920 days
100 μg$48720 days
200 μg$73920 days
500 μg$1,29020 days
1 mg$1,98020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Endonuclease V Protein, T. neapolitana, Recombinant (His) is expressed in Yeast. The accession number is B9K7P3.
Species
Thermotoga neapolitana
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberB9K7P3
Synonyms
nfi,Endonuclease V,Deoxyribonuclease V (DNase V),Deoxyinosine 3'endonuclease
Amino Acid
MTYKKLHEWDLSPEEAMKIQNVLREKILFKPFEGEPKYVAGVDLSFPKREEGLAVIVVMEYPTFKIVELVSERGKVDFPYIPGLLAFREGPLFLKAWEKLKTKPDVVVFDGQGIAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTYREPENRRCSWSYLYDNEEIIGCVMRTREGSAPIFVSPGHLIDVESSIRLVKSFTLPGRRLPEPTRMAHIYTQRLKKGLF
Construction
1-225 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight27.3 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 13 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.