Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ECHS1 Protein, Mouse, Recombinant (C225S, HA & His)

Catalog No. TMPH-02642

Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate. ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) is expressed in Baculovirus insect cells with N-10xHis, C-HA tag. The predicted molecular weight is 32.0 kDa and the accession number is Q8BH95.

ECHS1 Protein, Mouse, Recombinant (C225S, HA & His)

ECHS1 Protein, Mouse, Recombinant (C225S, HA & His)

Catalog No. TMPH-02642
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate. ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) is expressed in Baculovirus insect cells with N-10xHis, C-HA tag. The predicted molecular weight is 32.0 kDa and the accession number is Q8BH95.
Pack SizePriceAvailabilityQuantity
20 μg $49120 days
100 μg $1,50020 days
1 mg $2,96020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate. ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) is expressed in Baculovirus insect cells with N-10xHis, C-HA tag. The predicted molecular weight is 32.0 kDa and the accession number is Q8BH95.
Species
Mouse
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-HA
Accession NumberQ8BH95
Synonyms
Short-chain enoyl-CoA hydratase (SCEH),mitochondrial,mECH1,mECH,Enoyl-CoA hydratase, mitochondrial,Enoyl-CoA hydratase 1 (ECHS1),Echs1
Amino Acid
ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQSAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Construction
28-290 aa (C225S)
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight32.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords