ECHS1 Protein, Mouse, Recombinant (C225S, HA & His)

Name: ECHS1 Protein, Mouse, Recombinant (C225S, HA & His)
Brand: TargetMol
SKU: TMPH-02642
Rating: 4.5 (1 reviews)

(Synonyms: Short-chain enoyl-CoA hydratase (SCEH), mitochondrial, mECH1, mECH, Enoyl-CoA hydratase, mitochondrial, Enoyl-CoA hydratase 1 (ECHS1), Echs1) Copy Product Info

Synonyms: Short-chain enoyl-CoA hydratase (SCEH), mitochondrial, mECH1, mECH, Enoyl-CoA hydratase, mitochondrial, Enoyl-CoA hydratase 1 (ECHS1), Echs1

Catalog No. TMPH-02642 Copy Product Info

Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate. ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) is expressed in Baculovirus insect cells with N-10xHis, C-HA tag. The predicted molecular weight is 32.0 kDa and the accession number is Q8BH95.

ECHS1 Protein, Mouse, Recombinant (C225S, HA & His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$176	20 days	20 days
10 µg	$293	20 days	20 days
20 µg	$491	20 days	20 days
50 µg	$926	20 days	20 days
100 µg	$1,500	20 days	20 days
200 µg	$1,830	20 days	20 days
500 µg	$2,390	20 days	20 days
1 mg	$2,960	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate. ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) is expressed in Baculovirus insect cells with N-10xHis, C-HA tag. The predicted molecular weight is 32.0 kDa and the accession number is Q8BH95.
Species	Mouse
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-HA
Accession Number	Q8BH95
Amino Acid	ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQSAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Construction	28-290 aa (C225S)
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Short-chain enoyl-CoA hydratase (SCEH), mitochondrial, mECH1, mECH, Enoyl-CoA hydratase, mitochondrial, Enoyl-CoA hydratase 1 (ECHS1), Echs1
Research Background	Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate.

Chemical Properties

Molecular Weight

32.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

SCEHmECH 1ECHS1ECHS 1

Related Tags: ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) chemical structure | ECHS1 Protein, Mouse, Recombinant (C225S, HA & His) molecular weight