May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. |
Species | Mouse |
Expression System | E. coli |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Accession Number | Q9JMI0 |
Synonyms | Ecel1, Endothelin-converting enzyme-like 1, Dine, Xce, Damage-induced neuronal endopeptidase |
Amino Acid | MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 1-61 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 13.7 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
ECEL1 Protein, Mouse, Recombinant (His & Myc) Ecel1 Endothelin-converting enzyme-like 1 Dine Xce Damage-induced neuronal endopeptidase recombinant recombinant-proteins proteins protein