Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DPEP3 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04664

DPEP3 Protein, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q9H4B8.

DPEP3 Protein, Human, Recombinant (His)

DPEP3 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04664
DPEP3 Protein, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q9H4B8.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$4820 days20 days
10 μg$7520 days20 days
20 μg$12020 days20 days
50 μg$19620 days20 days
100 μg$29620 days20 days
200 μg$51820 days20 days
500 μg$1,08020 days20 days
1 mg$1,97020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody. The EC50 is 6.841-7.498 ng/mL.
Description
DPEP3 Protein, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q9H4B8.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberQ9H4B8
Synonyms
DPEP3,Dipeptidase 3
Amino Acid
AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS
Construction
36-463 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight48.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 301 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords