Shopping Cart
Remove All
Your shopping cart is currently empty
DPEP3 Protein, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q9H4B8.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $48 | 20 days | 20 days | |
| 10 μg | $75 | 20 days | 20 days | |
| 20 μg | $120 | 20 days | 20 days | |
| 50 μg | $196 | 20 days | 20 days | |
| 100 μg | $296 | 20 days | 20 days | |
| 200 μg | $518 | 20 days | 20 days | |
| 500 μg | $1,080 | 20 days | 20 days | |
| 1 mg | $1,970 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody. The EC50 is 6.841-7.498 ng/mL. |
| Description | DPEP3 Protein, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q9H4B8. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | Q9H4B8 |
| Synonyms | DPEP3,Dipeptidase 3 |
| Amino Acid | AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS |
| Construction | 36-463 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 48.3 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 301 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.