Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DOG1 Protein, S. cerevisiae, Recombinant (His)

Catalog No. TMPH-03429

Active on 2-DOG-6P, also very active on fructose-1P. DOG1 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.1 kDa and the accession number is P38774.

DOG1 Protein, S. cerevisiae, Recombinant (His)

DOG1 Protein, S. cerevisiae, Recombinant (His)

Catalog No. TMPH-03429
Active on 2-DOG-6P, also very active on fructose-1P. DOG1 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.1 kDa and the accession number is P38774.
Pack SizePriceAvailabilityQuantity
20 μg $39720 days
100 μg $84520 days
500 μg $1,95020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Active on 2-DOG-6P, also very active on fructose-1P. DOG1 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.1 kDa and the accession number is P38774.
Species
Saccharomyces cerevisiae
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP38774
Synonyms
DOG1,2-DOG-6-P 1,2-deoxyglucose-6-phosphate phosphatase 1,2-deoxyglucose-6-phosphatase 1
Amino Acid
MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Construction
1-246 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight29.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Active on 2-DOG-6P, also very active on fructose-1P.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords